Anti MIPOL1 pAb (ATL-HPA050179)

Atlas Antibodies

SKU:
ATL-HPA050179-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mirror-image polydactyly 1
Gene Name: MIPOL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047022: 43%, ENSRNOG00000009151: 43%
Entrez Gene ID: 145282
Uniprot ID: Q8TD10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKSTQPDEQLTMNSEKSMHRKSTELVNEITCENTEWPGQRSTNFQIISSYPDDESVYCTTEKYNVMEHRHNDMHYECMTPCQVTSDSDKEKTIAFLLKELDILRTSNKKLQQKLAKEDKEQRKLKFKLELQEKETEA
Gene Sequence NKSTQPDEQLTMNSEKSMHRKSTELVNEITCENTEWPGQRSTNFQIISSYPDDESVYCTTEKYNVMEHRHNDMHYECMTPCQVTSDSDKEKTIAFLLKELDILRTSNKKLQQKLAKEDKEQRKLKFKLELQEKETEA
Gene ID - Mouse ENSMUSG00000047022
Gene ID - Rat ENSRNOG00000009151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MIPOL1 pAb (ATL-HPA050179)
Datasheet Anti MIPOL1 pAb (ATL-HPA050179) Datasheet (External Link)
Vendor Page Anti MIPOL1 pAb (ATL-HPA050179) at Atlas Antibodies

Documents & Links for Anti MIPOL1 pAb (ATL-HPA050179)
Datasheet Anti MIPOL1 pAb (ATL-HPA050179) Datasheet (External Link)
Vendor Page Anti MIPOL1 pAb (ATL-HPA050179)