Anti MINOS1 pAb (ATL-HPA059930 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059930-25

• 
• 

Protein Description: mitochondrial inner membrane organizing system 1
Gene Name: MINOS1
Alternative Gene Name: C1orf151, FLJ36999, MIO10, RP5-1056L3.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050608: 95%, ENSRNOG00000042696: 92%
Entrez Gene ID: 440574
Uniprot ID: Q5TGZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
• Gene Sequence: RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
• Gene ID - Mouse: ENSMUSG00000050608
• Gene ID - Rat: ENSRNOG00000042696
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.