Protein Description: MINDY lysine 48 deubiquitinase 2
Gene Name: MINDY2
Alternative Gene Name: FAM63B, KIAA1164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042444: 50%, ENSRNOG00000061337: 52%
Entrez Gene ID: 54629
Uniprot ID: Q8NBR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MINDY2
Alternative Gene Name: FAM63B, KIAA1164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042444: 50%, ENSRNOG00000061337: 52%
Entrez Gene ID: 54629
Uniprot ID: Q8NBR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSSAGLDLKDSGLESPAAAEAPLRGQYKVTASPETAVAGVGHELGTAGDAGARPDLAGTCQAELTA |
| Documents & Links for Anti MINDY2 pAb (ATL-HPA063669) | |
| Datasheet | Anti MINDY2 pAb (ATL-HPA063669) Datasheet (External Link) |
| Vendor Page | Anti MINDY2 pAb (ATL-HPA063669) at Atlas |
| Documents & Links for Anti MINDY2 pAb (ATL-HPA063669) | |
| Datasheet | Anti MINDY2 pAb (ATL-HPA063669) Datasheet (External Link) |
| Vendor Page | Anti MINDY2 pAb (ATL-HPA063669) |