Anti MIF4GD pAb (ATL-HPA051222)

Atlas Antibodies

SKU:
ATL-HPA051222-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MIF4G domain containing
Gene Name: MIF4GD
Alternative Gene Name: AD023, MGC45027, MIFD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020743: 94%, ENSRNOG00000003837: 96%
Entrez Gene ID: 57409
Uniprot ID: A9UHW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL
Gene Sequence GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL
Gene ID - Mouse ENSMUSG00000020743
Gene ID - Rat ENSRNOG00000003837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MIF4GD pAb (ATL-HPA051222)
Datasheet Anti MIF4GD pAb (ATL-HPA051222) Datasheet (External Link)
Vendor Page Anti MIF4GD pAb (ATL-HPA051222) at Atlas Antibodies

Documents & Links for Anti MIF4GD pAb (ATL-HPA051222)
Datasheet Anti MIF4GD pAb (ATL-HPA051222) Datasheet (External Link)
Vendor Page Anti MIF4GD pAb (ATL-HPA051222)