Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA055922-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA055922 antibody. Corresponding MIA3 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A549 shows localization to vesicles.
  • Western blot analysis in human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: melanoma inhibitory activity family, member 3
Gene Name: MIA3
Alternative Gene Name: FLJ39207, KIAA0268, TANGO, UNQ6077
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038762: 25%, ENSRNOG00000058940: 26%
Entrez Gene ID: 375056
Uniprot ID: Q5JRA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA
Gene Sequence DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA
Gene ID - Mouse ENSMUSG00000038762
Gene ID - Rat ENSRNOG00000058940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation)
Datasheet Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation)
Datasheet Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation)



Citations for Anti MIA3 pAb (ATL-HPA055922 w/enhanced validation) – 3 Found
Kondo, Yuji; Fu, Jianxin; Wang, Hua; Hoover, Christopher; McDaniel, J Michael; Steet, Richard; Patra, Debabrata; Song, Jianhua; Pollard, Laura; Cathey, Sara; Yago, Tadayuki; Wiley, Graham; Macwana, Susan; Guthridge, Joel; McGee, Samuel; Li, Shibo; Griffin, Courtney; Furukawa, Koichi; James, Judith A; Ruan, Changgeng; McEver, Rodger P; Wierenga, Klaas J; Gaffney, Patrick M; Xia, Lijun. Site-1 protease deficiency causes human skeletal dysplasia due to defective inter-organelle protein trafficking. Jci Insight. 2018;3(14)  PubMed
Guillemyn, Brecht; Nampoothiri, Sheela; Syx, Delfien; Malfait, Fransiska; Symoens, Sofie. Loss of TANGO1 Leads to Absence of Bone Mineralization. Jbmr Plus. 2021;5(3):e10451.  PubMed
Cao, Qingqing; Tartaglia, Grace; Alexander, Michael; Park, Pyung Hung; Poojan, Shiv; Farshchian, Mehdi; Fuentes, Ignacia; Chen, Mei; McGrath, John A; Palisson, Francis; Salas-Alanis, Julio; South, Andrew P. Collagen VII maintains proteostasis in dermal fibroblasts by scaffolding TANGO1 cargo. Matrix Biology : Journal Of The International Society For Matrix Biology. 2022;111( 35779741):226-244.  PubMed