Anti MIA2 pAb (ATL-HPA055459)

Atlas Antibodies

SKU:
ATL-HPA055459-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: melanoma inhibitory activity 2
Gene Name: MIA2
Alternative Gene Name: FLJ22404
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000112695: 52%, ENSRNOG00000038832: 47%
Entrez Gene ID: 4253
Uniprot ID: Q96PC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
Gene Sequence TNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
Gene ID - Mouse ENSMUSG00000112695
Gene ID - Rat ENSRNOG00000038832
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MIA2 pAb (ATL-HPA055459)
Datasheet Anti MIA2 pAb (ATL-HPA055459) Datasheet (External Link)
Vendor Page Anti MIA2 pAb (ATL-HPA055459) at Atlas Antibodies

Documents & Links for Anti MIA2 pAb (ATL-HPA055459)
Datasheet Anti MIA2 pAb (ATL-HPA055459) Datasheet (External Link)
Vendor Page Anti MIA2 pAb (ATL-HPA055459)