Anti MGAT4B pAb (ATL-HPA052134)

Atlas Antibodies

SKU:
ATL-HPA052134-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme B
Gene Name: MGAT4B
Alternative Gene Name: GnT-Ivb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036620: 96%, ENSRNOG00000003235: 96%
Entrez Gene ID: 11282
Uniprot ID: Q9UQ53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL
Gene Sequence VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL
Gene ID - Mouse ENSMUSG00000036620
Gene ID - Rat ENSRNOG00000003235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MGAT4B pAb (ATL-HPA052134)
Datasheet Anti MGAT4B pAb (ATL-HPA052134) Datasheet (External Link)
Vendor Page Anti MGAT4B pAb (ATL-HPA052134) at Atlas Antibodies

Documents & Links for Anti MGAT4B pAb (ATL-HPA052134)
Datasheet Anti MGAT4B pAb (ATL-HPA052134) Datasheet (External Link)
Vendor Page Anti MGAT4B pAb (ATL-HPA052134)