Anti MFN1 pAb (ATL-HPA059230)

Atlas Antibodies

Catalog No.:
ATL-HPA059230-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitofusin 1
Gene Name: MFN1
Alternative Gene Name: FLJ20693
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027668: 88%, ENSRNOG00000011057: 88%
Entrez Gene ID: 55669
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGL
Gene Sequence SLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGL
Gene ID - Mouse ENSMUSG00000027668
Gene ID - Rat ENSRNOG00000011057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MFN1 pAb (ATL-HPA059230)
Datasheet Anti MFN1 pAb (ATL-HPA059230) Datasheet (External Link)
Vendor Page Anti MFN1 pAb (ATL-HPA059230) at Atlas Antibodies

Documents & Links for Anti MFN1 pAb (ATL-HPA059230)
Datasheet Anti MFN1 pAb (ATL-HPA059230) Datasheet (External Link)
Vendor Page Anti MFN1 pAb (ATL-HPA059230)