Anti MFHAS1 pAb (ATL-HPA054471)

Atlas Antibodies

SKU:
ATL-HPA054471-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: malignant fibrous histiocytoma amplified sequence 1
Gene Name: MFHAS1
Alternative Gene Name: LRRC65, MASL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070056: 92%, ENSRNOG00000011431: 92%
Entrez Gene ID: 9258
Uniprot ID: Q9Y4C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSP
Gene Sequence RVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSP
Gene ID - Mouse ENSMUSG00000070056
Gene ID - Rat ENSRNOG00000011431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MFHAS1 pAb (ATL-HPA054471)
Datasheet Anti MFHAS1 pAb (ATL-HPA054471) Datasheet (External Link)
Vendor Page Anti MFHAS1 pAb (ATL-HPA054471) at Atlas Antibodies

Documents & Links for Anti MFHAS1 pAb (ATL-HPA054471)
Datasheet Anti MFHAS1 pAb (ATL-HPA054471) Datasheet (External Link)
Vendor Page Anti MFHAS1 pAb (ATL-HPA054471)