Protein Description: mitochondrial fission factor
Gene Name: MFF
Alternative Gene Name: C2orf33, GL004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026150: 93%, ENSRNOG00000015428: 96%
Entrez Gene ID: 56947
Uniprot ID: Q9GZY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MFF
Alternative Gene Name: C2orf33, GL004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026150: 93%, ENSRNOG00000015428: 96%
Entrez Gene ID: 56947
Uniprot ID: Q9GZY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWH |
| Documents & Links for Anti MFF pAb (ATL-HPA074625) | |
| Datasheet | Anti MFF pAb (ATL-HPA074625) Datasheet (External Link) |
| Vendor Page | Anti MFF pAb (ATL-HPA074625) at Atlas |
| Documents & Links for Anti MFF pAb (ATL-HPA074625) | |
| Datasheet | Anti MFF pAb (ATL-HPA074625) Datasheet (External Link) |
| Vendor Page | Anti MFF pAb (ATL-HPA074625) |