Anti METTL9 pAb (ATL-HPA053588)

Atlas Antibodies

SKU:
ATL-HPA053588-100
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line SK-MEL-30
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 9
Gene Name: METTL9
Alternative Gene Name: DREV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030876: 99%, ENSRNOG00000025940: 100%
Entrez Gene ID: 51108
Uniprot ID: Q9H1A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVL
Gene Sequence VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVL
Gene ID - Mouse ENSMUSG00000030876
Gene ID - Rat ENSRNOG00000025940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti METTL9 pAb (ATL-HPA053588)
Datasheet Anti METTL9 pAb (ATL-HPA053588) Datasheet (External Link)
Vendor Page Anti METTL9 pAb (ATL-HPA053588) at Atlas Antibodies

Documents & Links for Anti METTL9 pAb (ATL-HPA053588)
Datasheet Anti METTL9 pAb (ATL-HPA053588) Datasheet (External Link)
Vendor Page Anti METTL9 pAb (ATL-HPA053588)