Anti METTL4 pAb (ATL-HPA046734)

Atlas Antibodies

SKU:
ATL-HPA046734-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 4
Gene Name: METTL4
Alternative Gene Name: FLJ23017, HsT661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055660: 78%, ENSRNOG00000026280: 77%
Entrez Gene ID: 64863
Uniprot ID: Q8N3J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTK
Gene Sequence IIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTK
Gene ID - Mouse ENSMUSG00000055660
Gene ID - Rat ENSRNOG00000026280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti METTL4 pAb (ATL-HPA046734)
Datasheet Anti METTL4 pAb (ATL-HPA046734) Datasheet (External Link)
Vendor Page Anti METTL4 pAb (ATL-HPA046734) at Atlas Antibodies

Documents & Links for Anti METTL4 pAb (ATL-HPA046734)
Datasheet Anti METTL4 pAb (ATL-HPA046734) Datasheet (External Link)
Vendor Page Anti METTL4 pAb (ATL-HPA046734)