Anti METTL13 pAb (ATL-HPA053705)

Atlas Antibodies

SKU:
ATL-HPA053705-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line PC-3
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 13
Gene Name: METTL13
Alternative Gene Name: CGI-01, KIAA0859
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026694: 91%, ENSRNOG00000027319: 27%
Entrez Gene ID: 51603
Uniprot ID: Q8N6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCP
Gene Sequence LALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCP
Gene ID - Mouse ENSMUSG00000026694
Gene ID - Rat ENSRNOG00000027319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti METTL13 pAb (ATL-HPA053705)
Datasheet Anti METTL13 pAb (ATL-HPA053705) Datasheet (External Link)
Vendor Page Anti METTL13 pAb (ATL-HPA053705) at Atlas Antibodies

Documents & Links for Anti METTL13 pAb (ATL-HPA053705)
Datasheet Anti METTL13 pAb (ATL-HPA053705) Datasheet (External Link)
Vendor Page Anti METTL13 pAb (ATL-HPA053705)