Anti METTL1 pAb (ATL-HPA050450)

Atlas Antibodies

SKU:
ATL-HPA050450-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 1
Gene Name: METTL1
Alternative Gene Name: C12orf1, TRM8, TRMT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006732: 90%, ENSRNOG00000047895: 89%
Entrez Gene ID: 4234
Uniprot ID: Q9UBP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ
Gene Sequence NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ
Gene ID - Mouse ENSMUSG00000006732
Gene ID - Rat ENSRNOG00000047895
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti METTL1 pAb (ATL-HPA050450)
Datasheet Anti METTL1 pAb (ATL-HPA050450) Datasheet (External Link)
Vendor Page Anti METTL1 pAb (ATL-HPA050450) at Atlas Antibodies

Documents & Links for Anti METTL1 pAb (ATL-HPA050450)
Datasheet Anti METTL1 pAb (ATL-HPA050450) Datasheet (External Link)
Vendor Page Anti METTL1 pAb (ATL-HPA050450)