Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053793-25

• 
• 

Protein Description: mesenchyme homeobox 2
Gene Name: MEOX2
Alternative Gene Name: GAX, MOX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036144: 95%, ENSRNOG00000006588: 96%
Entrez Gene ID: 4223
Uniprot ID: P50222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKR
• Gene Sequence: QQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKR
• Gene ID - Mouse: ENSMUSG00000036144
• Gene ID - Rat: ENSRNOG00000006588
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) – 2 Found

Proserpio, Carla; Galardi, Silvia; Desimio, Maria Giovanna; Michienzi, Alessandro; Doria, Margherita; Minutolo, Antonella; Matteucci, Claudia; Ciafrè, Silvia Anna. MEOX2 Regulates the Growth and Survival of Glioblastoma Stem Cells by Modulating Genes of the Glycolytic Pathway and Response to Hypoxia. Cancers. 2022;14(9) 

Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481.