Anti MEIS1 pAb (ATL-HPA056000)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056000-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MEIS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020160: 98%, ENSRNOG00000004606: 95%
Entrez Gene ID: 4211
Uniprot ID: O00470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSG |
| Gene Sequence | VIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSG |
| Gene ID - Mouse | ENSMUSG00000020160 |
| Gene ID - Rat | ENSRNOG00000004606 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEIS1 pAb (ATL-HPA056000) | |
| Datasheet | Anti MEIS1 pAb (ATL-HPA056000) Datasheet (External Link) |
| Vendor Page | Anti MEIS1 pAb (ATL-HPA056000) at Atlas Antibodies |
| Documents & Links for Anti MEIS1 pAb (ATL-HPA056000) | |
| Datasheet | Anti MEIS1 pAb (ATL-HPA056000) Datasheet (External Link) |
| Vendor Page | Anti MEIS1 pAb (ATL-HPA056000) |
| Citations for Anti MEIS1 pAb (ATL-HPA056000) – 2 Found |
| Le Nabec, Anaïs; Blotas, Clara; Briset, Alinéor; Collobert, Mégane; Férec, Claude; Moisan, Stéphanie. 3D Chromatin Organization Involving MEIS1 Factor in the cis-Regulatory Landscape of GJB2. International Journal Of Molecular Sciences. 2022;23(13) PubMed |
| Fabik, Jaroslav; Psutkova, Viktorie; Machon, Ondrej. Meis2 controls skeletal formation in the hyoid region. Frontiers In Cell And Developmental Biology. 10( 36247013):951063. PubMed |