Anti MEI1 pAb (ATL-HPA049240)

Atlas Antibodies

SKU:
ATL-HPA049240-25
  • Immunohistochemical staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: meiosis inhibitor 1
Gene Name: MEI1
Alternative Gene Name: MGC40042, SPATA38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068117: 86%, ENSRNOG00000007003: 81%
Entrez Gene ID: 150365
Uniprot ID: Q5TIA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HMKEKFSKKLASSSFIRLTLELKARFCSGLSHSALNQVCSNFLYYMCLNLLSAPEKTGPPSKEELSAVSELLQHGLPQISSRS
Gene Sequence HMKEKFSKKLASSSFIRLTLELKARFCSGLSHSALNQVCSNFLYYMCLNLLSAPEKTGPPSKEELSAVSELLQHGLPQISSRS
Gene ID - Mouse ENSMUSG00000068117
Gene ID - Rat ENSRNOG00000007003
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MEI1 pAb (ATL-HPA049240)
Datasheet Anti MEI1 pAb (ATL-HPA049240) Datasheet (External Link)
Vendor Page Anti MEI1 pAb (ATL-HPA049240) at Atlas Antibodies

Documents & Links for Anti MEI1 pAb (ATL-HPA049240)
Datasheet Anti MEI1 pAb (ATL-HPA049240) Datasheet (External Link)
Vendor Page Anti MEI1 pAb (ATL-HPA049240)