Anti MEF2A pAb (ATL-HPA046597)
Atlas Antibodies
- SKU:
- ATL-HPA046597-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MEF2A
Alternative Gene Name: RSRFC4, RSRFC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030557: 95%, ENSRNOG00000047756: 95%
Entrez Gene ID: 4205
Uniprot ID: Q02078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP |
Gene Sequence | DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP |
Gene ID - Mouse | ENSMUSG00000030557 |
Gene ID - Rat | ENSRNOG00000047756 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MEF2A pAb (ATL-HPA046597) | |
Datasheet | Anti MEF2A pAb (ATL-HPA046597) Datasheet (External Link) |
Vendor Page | Anti MEF2A pAb (ATL-HPA046597) at Atlas Antibodies |
Documents & Links for Anti MEF2A pAb (ATL-HPA046597) | |
Datasheet | Anti MEF2A pAb (ATL-HPA046597) Datasheet (External Link) |
Vendor Page | Anti MEF2A pAb (ATL-HPA046597) |