Protein Description: mediator complex subunit 6
Gene Name: MED6
Alternative Gene Name: NY-REN-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002679: 100%, ENSRNOG00000006976: 100%
Entrez Gene ID: 10001
Uniprot ID: O75586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MED6
Alternative Gene Name: NY-REN-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002679: 100%, ENSRNOG00000006976: 100%
Entrez Gene ID: 10001
Uniprot ID: O75586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ |
| Documents & Links for Anti MED6 pAb (ATL-HPA069039) | |
| Datasheet | Anti MED6 pAb (ATL-HPA069039) Datasheet (External Link) |
| Vendor Page | Anti MED6 pAb (ATL-HPA069039) at Atlas |
| Documents & Links for Anti MED6 pAb (ATL-HPA069039) | |
| Datasheet | Anti MED6 pAb (ATL-HPA069039) Datasheet (External Link) |
| Vendor Page | Anti MED6 pAb (ATL-HPA069039) |