Anti MED30 pAb (ATL-HPA045767)

Atlas Antibodies

SKU:
ATL-HPA045767-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 30
Gene Name: MED30
Alternative Gene Name: THRAP6, TRAP25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038622: 92%, ENSRNOG00000004844: 92%
Entrez Gene ID: 90390
Uniprot ID: Q96HR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY
Gene Sequence MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY
Gene ID - Mouse ENSMUSG00000038622
Gene ID - Rat ENSRNOG00000004844
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MED30 pAb (ATL-HPA045767)
Datasheet Anti MED30 pAb (ATL-HPA045767) Datasheet (External Link)
Vendor Page Anti MED30 pAb (ATL-HPA045767) at Atlas Antibodies

Documents & Links for Anti MED30 pAb (ATL-HPA045767)
Datasheet Anti MED30 pAb (ATL-HPA045767) Datasheet (External Link)
Vendor Page Anti MED30 pAb (ATL-HPA045767)