Anti MED26 pAb (ATL-HPA071835)
Atlas Antibodies
- SKU:
- ATL-HPA071835-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MED26
Alternative Gene Name: CRSP7, CRSP70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045248: 58%, ENSRNOG00000012270: 63%
Entrez Gene ID: 9441
Uniprot ID: O95402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSS |
Gene Sequence | ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSS |
Gene ID - Mouse | ENSMUSG00000045248 |
Gene ID - Rat | ENSRNOG00000012270 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MED26 pAb (ATL-HPA071835) | |
Datasheet | Anti MED26 pAb (ATL-HPA071835) Datasheet (External Link) |
Vendor Page | Anti MED26 pAb (ATL-HPA071835) at Atlas Antibodies |
Documents & Links for Anti MED26 pAb (ATL-HPA071835) | |
Datasheet | Anti MED26 pAb (ATL-HPA071835) Datasheet (External Link) |
Vendor Page | Anti MED26 pAb (ATL-HPA071835) |