Protein Description: mediator complex subunit 26
Gene Name: MED26
Alternative Gene Name: CRSP7, CRSP70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045248: 58%, ENSRNOG00000012270: 63%
Entrez Gene ID: 9441
Uniprot ID: O95402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MED26
Alternative Gene Name: CRSP7, CRSP70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045248: 58%, ENSRNOG00000012270: 63%
Entrez Gene ID: 9441
Uniprot ID: O95402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSS |
| Documents & Links for Anti MED26 pAb (ATL-HPA071835) | |
| Datasheet | Anti MED26 pAb (ATL-HPA071835) Datasheet (External Link) |
| Vendor Page | Anti MED26 pAb (ATL-HPA071835) at Atlas |
| Documents & Links for Anti MED26 pAb (ATL-HPA071835) | |
| Datasheet | Anti MED26 pAb (ATL-HPA071835) Datasheet (External Link) |
| Vendor Page | Anti MED26 pAb (ATL-HPA071835) |