Anti MED11 pAb (ATL-HPA056669)

Atlas Antibodies

SKU:
ATL-HPA056669-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in subset of glandular cells.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 11
Gene Name: MED11
Alternative Gene Name: HSPC296, MGC88387
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018923: 97%, ENSRNOG00000019384: 98%
Entrez Gene ID: 400569
Uniprot ID: Q9P086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLE
Gene Sequence YSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLE
Gene ID - Mouse ENSMUSG00000018923
Gene ID - Rat ENSRNOG00000019384
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MED11 pAb (ATL-HPA056669)
Datasheet Anti MED11 pAb (ATL-HPA056669) Datasheet (External Link)
Vendor Page Anti MED11 pAb (ATL-HPA056669) at Atlas Antibodies

Documents & Links for Anti MED11 pAb (ATL-HPA056669)
Datasheet Anti MED11 pAb (ATL-HPA056669) Datasheet (External Link)
Vendor Page Anti MED11 pAb (ATL-HPA056669)