Anti MED10 pAb (ATL-HPA054188)

Atlas Antibodies

SKU: ATL-HPA054188-25

• 

Protein Description: mediator complex subunit 10
Gene Name: MED10
Alternative Gene Name: L6, MGC5309, NUT2, TRG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021598: 98%, ENSRNOG00000017150: 98%
Entrez Gene ID: 84246
Uniprot ID: Q9BTT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP
• Gene Sequence: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP
• Gene ID - Mouse: ENSMUSG00000021598
• Gene ID - Rat: ENSRNOG00000017150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.