Anti MDH1 pAb (ATL-HPA054276)
Atlas Antibodies
- SKU:
- ATL-HPA054276-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MDH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020321: 98%, ENSRNOG00000008103: 98%
Entrez Gene ID: 4190
Uniprot ID: P40925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS |
Gene Sequence | DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS |
Gene ID - Mouse | ENSMUSG00000020321 |
Gene ID - Rat | ENSRNOG00000008103 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MDH1 pAb (ATL-HPA054276) | |
Datasheet | Anti MDH1 pAb (ATL-HPA054276) Datasheet (External Link) |
Vendor Page | Anti MDH1 pAb (ATL-HPA054276) at Atlas Antibodies |
Documents & Links for Anti MDH1 pAb (ATL-HPA054276) | |
Datasheet | Anti MDH1 pAb (ATL-HPA054276) Datasheet (External Link) |
Vendor Page | Anti MDH1 pAb (ATL-HPA054276) |