Anti MDH1 pAb (ATL-HPA054276)

Atlas Antibodies

SKU:
ATL-HPA054276-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: malate dehydrogenase 1, NAD (soluble)
Gene Name: MDH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020321: 98%, ENSRNOG00000008103: 98%
Entrez Gene ID: 4190
Uniprot ID: P40925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Gene Sequence DHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSS
Gene ID - Mouse ENSMUSG00000020321
Gene ID - Rat ENSRNOG00000008103
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MDH1 pAb (ATL-HPA054276)
Datasheet Anti MDH1 pAb (ATL-HPA054276) Datasheet (External Link)
Vendor Page Anti MDH1 pAb (ATL-HPA054276) at Atlas Antibodies

Documents & Links for Anti MDH1 pAb (ATL-HPA054276)
Datasheet Anti MDH1 pAb (ATL-HPA054276) Datasheet (External Link)
Vendor Page Anti MDH1 pAb (ATL-HPA054276)