Anti MDGA1 pAb (ATL-HPA050382)

Atlas Antibodies

SKU: ATL-HPA050382-25

• 

Protein Description: MAM domain containing glycosylphosphatidylinositol anchor 1
Gene Name: MDGA1
Alternative Gene Name: GPIM, MAMDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043557: 93%, ENSRNOG00000000536: 93%
Entrez Gene ID: 266727
Uniprot ID: Q8NFP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAA
• Gene Sequence: EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAA
• Gene ID - Mouse: ENSMUSG00000043557
• Gene ID - Rat: ENSRNOG00000000536
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.