Anti MCUB pAb (ATL-HPA048776 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048776-25
  • Immunohistochemistry analysis in human lymph node and liver tissues using HPA048776 antibody. Corresponding MCUB RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial calcium uniporter dominant negative beta subunit
Gene Name: MCUB
Alternative Gene Name: CCDC109B, FLJ20647
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027994: 75%, ENSRNOG00000009433: 74%
Entrez Gene ID: 55013
Uniprot ID: Q9NWR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE
Gene Sequence SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE
Gene ID - Mouse ENSMUSG00000027994
Gene ID - Rat ENSRNOG00000009433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MCUB pAb (ATL-HPA048776 w/enhanced validation)
Datasheet Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MCUB pAb (ATL-HPA048776 w/enhanced validation)
Datasheet Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MCUB pAb (ATL-HPA048776 w/enhanced validation)



Citations for Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) – 3 Found
Suarez, Jorge; Cividini, Federico; Scott, Brian T; Lehmann, Kim; Diaz-Juarez, Julieta; Diemer, Tanja; Dai, Anzhi; Suarez, Jorge A; Jain, Mohit; Dillmann, Wolfgang H. Restoring mitochondrial calcium uniporter expression in diabetic mouse heart improves mitochondrial calcium handling and cardiac function. The Journal Of Biological Chemistry. 2018;293(21):8182-8195.  PubMed
Mira, Rodrigo G; Quintanilla, Rodrigo A; Cerpa, Waldo. Mild Traumatic Brain Injury Induces Mitochondrial Calcium Overload and Triggers the Upregulation of NCLX in the Hippocampus. Antioxidants (Basel, Switzerland). 2023;12(2)  PubMed
Liu, Cong; Li, Hui-Juan; Duan, Wei-Xia; Duan, Yu; Yu, Qin; Zhang, Tian; Sun, Ya-Pei; Li, Yuan-Yuan; Liu, Yong-Sheng; Xu, Shang-Cheng. MCU Upregulation Overactivates Mitophagy by Promoting VDAC1 Dimerization and Ubiquitination in the Hepatotoxicity of Cadmium. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2023;10(7):e2203869.  PubMed