Anti MCUB pAb (ATL-HPA048776 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA048776-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MCUB
Alternative Gene Name: CCDC109B, FLJ20647
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027994: 75%, ENSRNOG00000009433: 74%
Entrez Gene ID: 55013
Uniprot ID: Q9NWR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE |
Gene Sequence | SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE |
Gene ID - Mouse | ENSMUSG00000027994 |
Gene ID - Rat | ENSRNOG00000009433 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) | |
Datasheet | Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) | |
Datasheet | Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) |
Citations for Anti MCUB pAb (ATL-HPA048776 w/enhanced validation) – 3 Found |
Suarez, Jorge; Cividini, Federico; Scott, Brian T; Lehmann, Kim; Diaz-Juarez, Julieta; Diemer, Tanja; Dai, Anzhi; Suarez, Jorge A; Jain, Mohit; Dillmann, Wolfgang H. Restoring mitochondrial calcium uniporter expression in diabetic mouse heart improves mitochondrial calcium handling and cardiac function. The Journal Of Biological Chemistry. 2018;293(21):8182-8195. PubMed |
Mira, Rodrigo G; Quintanilla, Rodrigo A; Cerpa, Waldo. Mild Traumatic Brain Injury Induces Mitochondrial Calcium Overload and Triggers the Upregulation of NCLX in the Hippocampus. Antioxidants (Basel, Switzerland). 2023;12(2) PubMed |
Liu, Cong; Li, Hui-Juan; Duan, Wei-Xia; Duan, Yu; Yu, Qin; Zhang, Tian; Sun, Ya-Pei; Li, Yuan-Yuan; Liu, Yong-Sheng; Xu, Shang-Cheng. MCU Upregulation Overactivates Mitophagy by Promoting VDAC1 Dimerization and Ubiquitination in the Hepatotoxicity of Cadmium. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2023;10(7):e2203869. PubMed |