Anti MCRIP2 pAb (ATL-HPA060363)

Atlas Antibodies

SKU: ATL-HPA060363-25

• 
• 

Protein Description: MAPK regulated corepressor interacting protein 2
Gene Name: MCRIP2
Alternative Gene Name: C16orf14, FAM195A, MGC15416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025732: 86%, ENSRNOG00000020029: 85%
Entrez Gene ID: 84331
Uniprot ID: Q9BUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EESVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDLDEWWAQQFLARITSC
• Gene Sequence: EESVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDLDEWWAQQFLARITSC
• Gene ID - Mouse: ENSMUSG00000025732
• Gene ID - Rat: ENSRNOG00000020029
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.