Anti MCOLN2 pAb (ATL-HPA048999)

Atlas Antibodies

SKU:
ATL-HPA048999-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to intermediate filaments.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mucolipin 2
Gene Name: MCOLN2
Alternative Gene Name: FLJ36691, TRP-ML2, TRPML2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011008: 36%, ENSRNOG00000015089: 36%
Entrez Gene ID: 255231
Uniprot ID: Q8IZK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKF
Gene Sequence MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKF
Gene ID - Mouse ENSMUSG00000011008
Gene ID - Rat ENSRNOG00000015089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MCOLN2 pAb (ATL-HPA048999)
Datasheet Anti MCOLN2 pAb (ATL-HPA048999) Datasheet (External Link)
Vendor Page Anti MCOLN2 pAb (ATL-HPA048999) at Atlas Antibodies

Documents & Links for Anti MCOLN2 pAb (ATL-HPA048999)
Datasheet Anti MCOLN2 pAb (ATL-HPA048999) Datasheet (External Link)
Vendor Page Anti MCOLN2 pAb (ATL-HPA048999)