Anti MCM5 pAb (ATL-HPA052880)

Atlas Antibodies

SKU:
ATL-HPA052880-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: minichromosome maintenance complex component 5
Gene Name: MCM5
Alternative Gene Name: CDC46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005410: 96%, ENSRNOG00000014336: 95%
Entrez Gene ID: 4174
Uniprot ID: P33992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYE
Gene Sequence GYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYE
Gene ID - Mouse ENSMUSG00000005410
Gene ID - Rat ENSRNOG00000014336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MCM5 pAb (ATL-HPA052880)
Datasheet Anti MCM5 pAb (ATL-HPA052880) Datasheet (External Link)
Vendor Page Anti MCM5 pAb (ATL-HPA052880) at Atlas Antibodies

Documents & Links for Anti MCM5 pAb (ATL-HPA052880)
Datasheet Anti MCM5 pAb (ATL-HPA052880) Datasheet (External Link)
Vendor Page Anti MCM5 pAb (ATL-HPA052880)