Anti MCM10 pAb (ATL-HPA045899 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045899-25
  • Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and MCM10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402694).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: minichromosome maintenance complex component 10
Gene Name: MCM10
Alternative Gene Name: CNA43, DNA43, PRO2249
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026669: 80%, ENSRNOG00000017981: 79%
Entrez Gene ID: 55388
Uniprot ID: Q7L590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTTLSNLVVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASALLKQQKQRMLEMRRRKSEEIQK
Gene Sequence QTTLSNLVVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASALLKQQKQRMLEMRRRKSEEIQK
Gene ID - Mouse ENSMUSG00000026669
Gene ID - Rat ENSRNOG00000017981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MCM10 pAb (ATL-HPA045899 w/enhanced validation)
Datasheet Anti MCM10 pAb (ATL-HPA045899 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MCM10 pAb (ATL-HPA045899 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MCM10 pAb (ATL-HPA045899 w/enhanced validation)
Datasheet Anti MCM10 pAb (ATL-HPA045899 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MCM10 pAb (ATL-HPA045899 w/enhanced validation)