Anti MCIDAS pAb (ATL-HPA058073)

Atlas Antibodies

SKU:
ATL-HPA058073-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: multiciliate differentiation and DNA synthesis associated cell cycle protein
Gene Name: MCIDAS
Alternative Gene Name: IDAS, MCI, MCIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074651: 81%, ENSRNOG00000039588: 78%
Entrez Gene ID: 345643
Uniprot ID: D6RGH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWV
Gene Sequence ANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWV
Gene ID - Mouse ENSMUSG00000074651
Gene ID - Rat ENSRNOG00000039588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MCIDAS pAb (ATL-HPA058073)
Datasheet Anti MCIDAS pAb (ATL-HPA058073) Datasheet (External Link)
Vendor Page Anti MCIDAS pAb (ATL-HPA058073) at Atlas Antibodies

Documents & Links for Anti MCIDAS pAb (ATL-HPA058073)
Datasheet Anti MCIDAS pAb (ATL-HPA058073) Datasheet (External Link)
Vendor Page Anti MCIDAS pAb (ATL-HPA058073)



Citations for Anti MCIDAS pAb (ATL-HPA058073) – 1 Found
Chen, Qianmin; Tan, Kai Sen; Liu, Jing; Ong, Hsiao Hui; Zhou, Suizi; Huang, Hongming; Chen, Hailing; Ong, Yew Kwang; Thong, Mark; Chow, Vincent T; Qiu, Qianhui; Wang, De-Yun. Host Antiviral Response Suppresses Ciliogenesis and Motile Ciliary Functions in the Nasal Epithelium. Frontiers In Cell And Developmental Biology. 8( 33409274):581340.  PubMed