Anti MBD3L3 pAb (ATL-HPA051259)

Atlas Antibodies

SKU: ATL-HPA051259-25

• 

Protein Description: methyl-CpG binding domain protein 3 like 3
Gene Name: MBD3L3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047508: 42%, ENSRNOG00000026629: 46%
Entrez Gene ID: 653657
Uniprot ID: A6NE82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQV
• Gene Sequence: MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQV
• Gene ID - Mouse: ENSMUSG00000047508
• Gene ID - Rat: ENSRNOG00000026629
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.