Protein Description: MYC-associated zinc finger protein (purine-binding transcription factor)
Gene Name: MAZ
Alternative Gene Name: Pur-1, ZF87, Zif87, ZNF801
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030678: 100%, ENSRNOG00000055082: 100%
Entrez Gene ID: 4150
Uniprot ID: P56270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAZ
Alternative Gene Name: Pur-1, ZF87, Zif87, ZNF801
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030678: 100%, ENSRNOG00000055082: 100%
Entrez Gene ID: 4150
Uniprot ID: P56270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMA |
Documents & Links for Anti MAZ pAb (ATL-HPA065930) | |
Datasheet | Anti MAZ pAb (ATL-HPA065930) Datasheet (External Link) |
Vendor Page | Anti MAZ pAb (ATL-HPA065930) at Atlas |
Documents & Links for Anti MAZ pAb (ATL-HPA065930) | |
Datasheet | Anti MAZ pAb (ATL-HPA065930) Datasheet (External Link) |
Vendor Page | Anti MAZ pAb (ATL-HPA065930) |