Anti MAU2 pAb (ATL-HPA059897)

Atlas Antibodies

SKU:
ATL-HPA059897-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MAU2 sister chromatid cohesion factor
Gene Name: MAU2
Alternative Gene Name: KIAA0892, mau-2, MAU2L, MGC75361, SCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031858: 100%, ENSRNOG00000020526: 100%
Entrez Gene ID: 23383
Uniprot ID: Q9Y6X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPRLFSNHAAQ
Gene Sequence HWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPRLFSNHAAQ
Gene ID - Mouse ENSMUSG00000031858
Gene ID - Rat ENSRNOG00000020526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAU2 pAb (ATL-HPA059897)
Datasheet Anti MAU2 pAb (ATL-HPA059897) Datasheet (External Link)
Vendor Page Anti MAU2 pAb (ATL-HPA059897) at Atlas Antibodies

Documents & Links for Anti MAU2 pAb (ATL-HPA059897)
Datasheet Anti MAU2 pAb (ATL-HPA059897) Datasheet (External Link)
Vendor Page Anti MAU2 pAb (ATL-HPA059897)