Protein Description: MAS1 proto-oncogene, G protein-coupled receptor
Gene Name: MAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068037: 85%, ENSRNOG00000014971: 85%
Entrez Gene ID: 4142
Uniprot ID: P04201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068037: 85%, ENSRNOG00000014971: 85%
Entrez Gene ID: 4142
Uniprot ID: P04201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV |
Documents & Links for Anti MAS1 pAb (ATL-HPA079325) | |
Datasheet | Anti MAS1 pAb (ATL-HPA079325) Datasheet (External Link) |
Vendor Page | Anti MAS1 pAb (ATL-HPA079325) at Atlas |
Documents & Links for Anti MAS1 pAb (ATL-HPA079325) | |
Datasheet | Anti MAS1 pAb (ATL-HPA079325) Datasheet (External Link) |
Vendor Page | Anti MAS1 pAb (ATL-HPA079325) |