Anti MARCKS pAb (ATL-HPA069443 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA069443-25
  • Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-MARCKS antibody. Corresponding MARCKS RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: myristoylated alanine rich protein kinase C substrate
Gene Name: MARCKS
Alternative Gene Name: 80K-L, MACS, PKCSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069662: 97%, ENSRNOG00000000579: 100%
Entrez Gene ID: 4082
Uniprot ID: P29966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
Gene Sequence MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
Gene ID - Mouse ENSMUSG00000069662
Gene ID - Rat ENSRNOG00000000579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti MARCKS pAb (ATL-HPA069443 w/enhanced validation)
Datasheet Anti MARCKS pAb (ATL-HPA069443 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MARCKS pAb (ATL-HPA069443 w/enhanced validation)