Anti MARCKS pAb (ATL-HPA054820)

Atlas Antibodies

SKU: ATL-HPA054820-25

• 

Protein Description: myristoylated alanine-rich protein kinase C substrate
Gene Name: MARCKS
Alternative Gene Name: 80K-L, MACS, PKCSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069662: 97%, ENSRNOG00000000579: 100%
Entrez Gene ID: 4082
Uniprot ID: P29966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
• Gene Sequence: MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
• Gene ID - Mouse: ENSMUSG00000069662
• Gene ID - Rat: ENSRNOG00000000579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.