Anti MAPK8IP1 pAb (ATL-HPA070332)

Atlas Antibodies

SKU: ATL-HPA070332-25

• 

Protein Description: mitogen-activated protein kinase 8 interacting protein 1
Gene Name: MAPK8IP1
Alternative Gene Name: IB1, JIP-1, JIP1, PRKM8IP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027223: 95%, ENSRNOG00000058478: 97%
Entrez Gene ID: 9479
Uniprot ID: Q9UQF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAY
• Gene Sequence: GHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAY
• Gene ID - Mouse: ENSMUSG00000027223
• Gene ID - Rat: ENSRNOG00000058478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.