Anti MAP7D2 pAb (ATL-HPA051508)

Atlas Antibodies

SKU: ATL-HPA051508-25

• 
• 

Protein Description: MAP7 domain containing 2
Gene Name: MAP7D2
Alternative Gene Name: FLJ14503
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041020: 58%, ENSRNOG00000005176: 56%
Entrez Gene ID: 256714
Uniprot ID: Q96T17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKTTKPPYPGSPVKYRLPALSGQDMPKRKAEKEKSNKEREGTLAQQAAGPQGEEALEKHVVDKHASEKHAAAAGGKAENSAALGKPTAGTTDAG
• Gene Sequence: PKTTKPPYPGSPVKYRLPALSGQDMPKRKAEKEKSNKEREGTLAQQAAGPQGEEALEKHVVDKHASEKHAAAAGGKAENSAALGKPTAGTTDAG
• Gene ID - Mouse: ENSMUSG00000041020
• Gene ID - Rat: ENSRNOG00000005176
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAP7D2 pAb (ATL-HPA051508) – 2 Found

Hooikaas, Peter Jan; Martin, Maud; Mühlethaler, Tobias; Kuijntjes, Gert-Jan; Peeters, Cathelijn A E; Katrukha, Eugene A; Ferrari, Luca; Stucchi, Riccardo; Verhagen, Daan G F; van Riel, Wilhelmina E; Grigoriev, Ilya; Altelaar, A F Maarten; Hoogenraad, Casper C; Rüdiger, Stefan G D; Steinmetz, Michel O; Kapitein, Lukas C; Akhmanova, Anna. MAP7 family proteins regulate kinesin-1 recruitment and activation. The Journal Of Cell Biology. 2019;218(4):1298-1318. 

Pan, Xingxiu; Cao, Yujie; Stucchi, Riccardo; Hooikaas, Peter Jan; Portegies, Sybren; Will, Lena; Martin, Maud; Akhmanova, Anna; Harterink, Martin; Hoogenraad, Casper C. MAP7D2 Localizes to the Proximal Axon and Locally Promotes Kinesin-1-Mediated Cargo Transport into the Axon. Cell Reports. 2019;26(8):1988-1999.e6.