Protein Description: mitogen-activated protein kinase kinase kinase 5
Gene Name: MAP3K5
Alternative Gene Name: ASK1, MAPKKK5, MEKK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071369: 69%, ENSRNOG00000031700: 66%
Entrez Gene ID: 4217
Uniprot ID: Q99683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAP3K5
Alternative Gene Name: ASK1, MAPKKK5, MEKK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071369: 69%, ENSRNOG00000031700: 66%
Entrez Gene ID: 4217
Uniprot ID: Q99683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVA |
Documents & Links for Anti MAP3K5 pAb (ATL-HPA063245) | |
Datasheet | Anti MAP3K5 pAb (ATL-HPA063245) Datasheet (External Link) |
Vendor Page | Anti MAP3K5 pAb (ATL-HPA063245) at Atlas |
Documents & Links for Anti MAP3K5 pAb (ATL-HPA063245) | |
Datasheet | Anti MAP3K5 pAb (ATL-HPA063245) Datasheet (External Link) |
Vendor Page | Anti MAP3K5 pAb (ATL-HPA063245) |