Protein Description: mitogen-activated protein kinase kinase kinase 12
Gene Name: MAP3K12
Alternative Gene Name: DLK, MEKK12, MUK, ZPK, ZPKP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023050: 100%, ENSRNOG00000015134: 100%
Entrez Gene ID: 7786
Uniprot ID: Q12852
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAP3K12
Alternative Gene Name: DLK, MEKK12, MUK, ZPK, ZPKP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023050: 100%, ENSRNOG00000015134: 100%
Entrez Gene ID: 7786
Uniprot ID: Q12852
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL |
Documents & Links for Anti MAP3K12 pAb (ATL-HPA071996) | |
Datasheet | Anti MAP3K12 pAb (ATL-HPA071996) Datasheet (External Link) |
Vendor Page | Anti MAP3K12 pAb (ATL-HPA071996) at Atlas |
Documents & Links for Anti MAP3K12 pAb (ATL-HPA071996) | |
Datasheet | Anti MAP3K12 pAb (ATL-HPA071996) Datasheet (External Link) |
Vendor Page | Anti MAP3K12 pAb (ATL-HPA071996) |