Anti MAP2K4 pAb (ATL-HPA060074)

Atlas Antibodies

SKU: ATL-HPA060074-25

• 
• 

Protein Description: mitogen-activated protein kinase kinase 4
Gene Name: MAP2K4
Alternative Gene Name: JNKK1, MEK4, MKK4, PRKMK4, SERK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033352: 97%, ENSRNOG00000003834: 88%
Entrez Gene ID: 6416
Uniprot ID: P45985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
• Gene Sequence: PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
• Gene ID - Mouse: ENSMUSG00000033352
• Gene ID - Rat: ENSRNOG00000003834
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.