Anti MAP1LC3B pAb (ATL-HPA053767)
Atlas Antibodies
- SKU:
- ATL-HPA053767-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MAP1LC3B
Alternative Gene Name: ATG8F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 97%, ENSRNOG00000017905: 97%
Entrez Gene ID: 81631
Uniprot ID: Q9GZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPSEKTFKQRRTFEQRVEDVRLIREQHPTK |
| Gene Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTK |
| Gene ID - Mouse | ENSMUSG00000031812 |
| Gene ID - Rat | ENSRNOG00000017905 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAP1LC3B pAb (ATL-HPA053767) | |
| Datasheet | Anti MAP1LC3B pAb (ATL-HPA053767) Datasheet (External Link) |
| Vendor Page | Anti MAP1LC3B pAb (ATL-HPA053767) at Atlas Antibodies |
| Documents & Links for Anti MAP1LC3B pAb (ATL-HPA053767) | |
| Datasheet | Anti MAP1LC3B pAb (ATL-HPA053767) Datasheet (External Link) |
| Vendor Page | Anti MAP1LC3B pAb (ATL-HPA053767) |
| Citations for Anti MAP1LC3B pAb (ATL-HPA053767) – 1 Found |
| Qureshi-Baig, Komal; Kuhn, Diana; Viry, Elodie; Pozdeev, Vitaly I; Schmitz, Martine; Rodriguez, Fabien; Ullmann, Pit; Koncina, Eric; Nurmik, Martin; Frasquilho, Sonia; Nazarov, Petr V; Zuegel, Nikolaus; Boulmont, Marc; Karapetyan, Yervand; Antunes, Laurent; Val, Daniel; Mittelbronn, Michel; Janji, Bassam; Haan, Serge; Letellier, Elisabeth. Hypoxia-induced autophagy drives colorectal cancer initiation and progression by activating the PRKC/PKC-EZR (ezrin) pathway. Autophagy. 2020;16(8):1436-1452. PubMed |