Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA059299-100
  • Immunohistochemistry analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RT4 shows localization to mitochondria.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: monoamine oxidase A
Gene Name: MAOA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025037: 85%, ENSRNOG00000002848: 83%
Entrez Gene ID: 4128
Uniprot ID: P21397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Gene Sequence VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Gene ID - Mouse ENSMUSG00000025037
Gene ID - Rat ENSRNOG00000002848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)
Datasheet Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)
Datasheet Anti MAOA pAb (ATL-HPA059299 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAOA pAb (ATL-HPA059299 w/enhanced validation)