Anti MANBA pAb (ATL-HPA053478)

Atlas Antibodies

SKU:
ATL-HPA053478-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic positivity, with a granular pattern in glandular cells.
  • Immunofluorescent staining of human cell line A549 shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mannosidase, beta A, lysosomal
Gene Name: MANBA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028164: 75%, ENSRNOG00000052247: 72%
Entrez Gene ID: 4126
Uniprot ID: O00462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTS
Gene Sequence LSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTS
Gene ID - Mouse ENSMUSG00000028164
Gene ID - Rat ENSRNOG00000052247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MANBA pAb (ATL-HPA053478)
Datasheet Anti MANBA pAb (ATL-HPA053478) Datasheet (External Link)
Vendor Page Anti MANBA pAb (ATL-HPA053478) at Atlas Antibodies

Documents & Links for Anti MANBA pAb (ATL-HPA053478)
Datasheet Anti MANBA pAb (ATL-HPA053478) Datasheet (External Link)
Vendor Page Anti MANBA pAb (ATL-HPA053478)