Protein Description: mannosidase alpha class 2A member 2
Gene Name: MAN2A2
Alternative Gene Name: HsT19662, MANA2X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038886: 79%, ENSRNOG00000012055: 80%
Entrez Gene ID: 4122
Uniprot ID: P49641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAN2A2
Alternative Gene Name: HsT19662, MANA2X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038886: 79%, ENSRNOG00000012055: 80%
Entrez Gene ID: 4122
Uniprot ID: P49641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD |
Documents & Links for Anti MAN2A2 pAb (ATL-HPA077930) | |
Datasheet | Anti MAN2A2 pAb (ATL-HPA077930) Datasheet (External Link) |
Vendor Page | Anti MAN2A2 pAb (ATL-HPA077930) at Atlas |
Documents & Links for Anti MAN2A2 pAb (ATL-HPA077930) | |
Datasheet | Anti MAN2A2 pAb (ATL-HPA077930) Datasheet (External Link) |
Vendor Page | Anti MAN2A2 pAb (ATL-HPA077930) |