Anti MAN2A2 pAb (ATL-HPA077930)

Catalog No:
ATL-HPA077930-25
$447.00
Protein Description: mannosidase alpha class 2A member 2
Gene Name: MAN2A2
Alternative Gene Name: HsT19662, MANA2X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038886: 79%, ENSRNOG00000012055: 80%
Entrez Gene ID: 4122
Uniprot ID: P49641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD
Gene ID - Mouse ENSMUSG00000038886
Gene ID - Rat ENSMUSG00000038886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MAN2A2 pAb (ATL-HPA077930)
Datasheet Anti MAN2A2 pAb (ATL-HPA077930) Datasheet (External Link)
Vendor Page Anti MAN2A2 pAb (ATL-HPA077930) at Atlas

Documents & Links for Anti MAN2A2 pAb (ATL-HPA077930)
Datasheet Anti MAN2A2 pAb (ATL-HPA077930) Datasheet (External Link)
Vendor Page Anti MAN2A2 pAb (ATL-HPA077930)