Anti MAN2A2 pAb (ATL-HPA077930)

Atlas Antibodies

SKU: ATL-HPA077930-25

• 

Product Description

Protein Description: mannosidase alpha class 2A member 2
Gene Name: MAN2A2
Alternative Gene Name: HsT19662, MANA2X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038886: 79%, ENSRNOG00000012055: 80%
Entrez Gene ID: 4122
Uniprot ID: P49641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD
• Gene Sequence: TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD
• Gene ID - Mouse: ENSMUSG00000038886
• Gene ID - Rat: ENSRNOG00000012055
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links