Anti MAN1A1 pAb (ATL-HPA053198)

Atlas Antibodies

SKU: ATL-HPA053198-25

• 
• 

Protein Description: mannosidase, alpha, class 1A, member 1
Gene Name: MAN1A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003746: 86%, ENSRNOG00000000800: 86%
Entrez Gene ID: 4121
Uniprot ID: P33908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK
• Gene Sequence: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK
• Gene ID - Mouse: ENSMUSG00000003746
• Gene ID - Rat: ENSRNOG00000000800
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.