Anti MAML1 pAb (ATL-HPA057531)

Atlas Antibodies

SKU:
ATL-HPA057531-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mastermind-like transcriptional coactivator 1
Gene Name: MAML1
Alternative Gene Name: KIAA0200, Mam-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050567: 81%, ENSRNOG00000003268: 80%
Entrez Gene ID: 9794
Uniprot ID: Q92585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGHAHIPRQTNVGQNT
Gene Sequence PQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGHAHIPRQTNVGQNT
Gene ID - Mouse ENSMUSG00000050567
Gene ID - Rat ENSRNOG00000003268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAML1 pAb (ATL-HPA057531)
Datasheet Anti MAML1 pAb (ATL-HPA057531) Datasheet (External Link)
Vendor Page Anti MAML1 pAb (ATL-HPA057531) at Atlas Antibodies

Documents & Links for Anti MAML1 pAb (ATL-HPA057531)
Datasheet Anti MAML1 pAb (ATL-HPA057531) Datasheet (External Link)
Vendor Page Anti MAML1 pAb (ATL-HPA057531)