Anti MAMDC4 pAb (ATL-HPA059977)

Atlas Antibodies

SKU: ATL-HPA059977-25

• 
• 

Protein Description: MAM domain containing 4
Gene Name: MAMDC4
Alternative Gene Name: AEGP, DKFZp434M1411
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026941: 77%, ENSRNOG00000016584: 79%
Entrez Gene ID: 158056
Uniprot ID: Q6UXC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VCNFVCDCRDCSDEAQCGYHGASPTLGAPFACDFEQDPCGWRDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDL
• Gene Sequence: VCNFVCDCRDCSDEAQCGYHGASPTLGAPFACDFEQDPCGWRDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDL
• Gene ID - Mouse: ENSMUSG00000026941
• Gene ID - Rat: ENSRNOG00000016584
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.