Anti MALRD1 pAb (ATL-HPA046848)

Atlas Antibodies

SKU:
ATL-HPA046848-25
  • Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: MAM and LDL receptor class A domain containing 1
Gene Name: MALRD1
Alternative Gene Name: bA265G8.2, C10orf112, Diet1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075520: 70%, ENSRNOG00000052916: 71%
Entrez Gene ID: 340895
Uniprot ID: Q5VYJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSTVIWRVLYNQGKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKLRLCD
Gene Sequence DSTVIWRVLYNQGKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKLRLCD
Gene ID - Mouse ENSMUSG00000075520
Gene ID - Rat ENSRNOG00000052916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MALRD1 pAb (ATL-HPA046848)
Datasheet Anti MALRD1 pAb (ATL-HPA046848) Datasheet (External Link)
Vendor Page Anti MALRD1 pAb (ATL-HPA046848) at Atlas Antibodies

Documents & Links for Anti MALRD1 pAb (ATL-HPA046848)
Datasheet Anti MALRD1 pAb (ATL-HPA046848) Datasheet (External Link)
Vendor Page Anti MALRD1 pAb (ATL-HPA046848)